PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G25720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BES1
Protein Properties Length: 192aa    MW: 20504.8 Da    PI: 4.8233
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G25720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82230.21.5e-0925689145
        DUF822  89 spesslq.sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                   sp+ss+q +s+ ss+++spv+sy+asp+sssfpsps+ld++s    ++llp+l+ l++
  OB07G25720.1   2 SPCSSTQlLSAPSSSFPSPVPSYHASPASSSFPSPSRLDNASP---SCLLPFLRGLPN 56 
                   89*****9*******************************9854...688888877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.4E-6142IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSPCSSTQLL SAPSSSFPSP VPSYHASPAS SSFPSPSRLD NASPSCLLPF LRGLPNLPPL  60
RVSSSAPIRK PDWDVDPFRH PFFAVSAPAS PTRGRRLEHP DTIPECDESD VSTVDSGRWI  120
SFQMATTAPT SPTYNLVNPG ASNSNSMEIE GAAGRGGPEF EFDKGRVTPW EGERIHEVAA  180
EELELTLGVG AK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00073ChIP-chipTransfer from AT1G19350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1067481e-166AK106748.1 Oryza sativa Japonica Group cDNA clone:002-115-C06, full insert sequence.
GenBankAP0042761e-166AP004276.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0453G03.
GenBankAP0149631e-166AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126151e-166CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658737.11e-110PREDICTED: protein BZR1 homolog 1
SwissprotB8B7S51e-109BZR1_ORYSI; Protein BZR1 homolog 1
SwissprotQ7XI961e-109BZR1_ORYSJ; Protein BZR1 homolog 1
TrEMBLJ3MME01e-136J3MME0_ORYBR; Uncharacterized protein
STRINGOB07G25720.11e-136(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.63e-41BES1 family protein